PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020765m
Common NameCARUB_v10020765mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 280aa    MW: 31177.2 Da    PI: 6.6472
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020765mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.43.1e-33139196259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  Carubv10020765m 139 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSEDPSIVITTYEGQHCHQ 196
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-34123197IPR003657WRKY domain
SuperFamilySSF1182901.96E-28130196IPR003657WRKY domain
PROSITE profilePS5081129.838133198IPR003657WRKY domain
SMARTSM007749.6E-39138197IPR003657WRKY domain
PfamPF031063.4E-26139196IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MNDPPDLRND DDSAAWRELT ASDSDFFDRD TSTILSDFGW SLDHSSDHPR NLSDLAPTTT  60
KTHPSSTSSC SSSVLVAVTE VSTPTTNPSA TSSSSDDPAD NSAAKTPPET PLKEKKKAQK  120
RIRQPRFAFM TKSDVDNLED GYRWRKYGQK AVKNSPFPRS YYRCTNSRCT VKKRVERSSE  180
DPSIVITTYE GQHCHQTIGF PRGGILTAHD PHSFTSHHHL PPPLPNPYYY QELLHQLHRD  240
NNTPSPRLLQ STTEDAPTIS NPSEEGLLGD IVPQTMRNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25128195774Probable WRKY transcription factor 4
2lex_A1e-25128195774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0718490.0AY071849.1 Arabidopsis thaliana WRKY transcription factor 57 (WRKY57) mRNA, complete cds.
GenBankBT0260570.0BT026057.1 Arabidopsis thaliana At1g69310 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302661.10.0hypothetical protein CARUB_v10020765mg
SwissprotQ9C9831e-140WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLR0I0700.0R0I070_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1186__AT1G69310.11e-140(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49952753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-110WRKY DNA-binding protein 57